PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_30678
Common NameKK1_030328
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family Nin-like
Protein Properties Length: 230aa    MW: 26832.3 Da    PI: 9.8972
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_30678genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK80.32e-25123170552
         RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    +++e+++kyF+ pi++AAk+++v+lT+LKr+CR+++I+RWPhRk+ksl
  C.cajan_30678 123 LEFEQIKKYFDVPINEAAKKMDVGLTLLKRRCRELNIMRWPHRKLKSL 170
                    79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.95104191IPR003035RWP-RK domain
PfamPF020421.8E-22123170IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MEVSPLEGFY EHDWTHHFPY SSKQLCFNEL PDIENFNFDL SLPLLGEEME EVEQKPLKVV  60
VPQKGHGDRD KGFGGALVVN EKGFATRVKK EEEENVDKKP LPVPRSNMKK KKKNNNNKKS  120
CVLEFEQIKK YFDVPINEAA KKMDVGLTLL KRRCRELNIM RWPHRKLKSL QTVIDNVKEL  180
GLANEIAMLE KHKRMLEKLP GLELSEETKK LRQACFKANY KRRRCLALKA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1108118KKKKKNNNNKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014517216.11e-102PREDICTED: protein RKD4
TrEMBLA0A151RZY21e-169A0A151RZY2_CAJCA; Uncharacterized protein
STRINGGLYMA06G13540.27e-91(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.12e-40RWP-RK domain-containing protein